![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein RNA-binding protein 8 [89938] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries) RBM8A, Y14 |
![]() | Domain d2j0qd1: 2j0q D:66-154 [137909] Other proteins in same PDB: d2j0qa1, d2j0qa2, d2j0qb1, d2j0qb2, d2j0qc1, d2j0qf1 automatically matched to d1p27b_ protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0q (more details), 3.2 Å
SCOPe Domain Sequences for d2j0qd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0qd1 d.58.7.1 (D:66-154) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]} pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk eaqaameglngqdlmgqpisvdwcfvrgp
Timeline for d2j0qd1: