Lineage for d2j0qd1 (2j0q D:66-154)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195315Protein RNA-binding protein 8 [89938] (2 species)
  7. 2195321Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries)
    RBM8A, Y14
  8. 2195326Domain d2j0qd1: 2j0q D:66-154 [137909]
    Other proteins in same PDB: d2j0qa1, d2j0qa2, d2j0qb1, d2j0qb2, d2j0qc1, d2j0qf1
    automatically matched to d1p27b_
    protein/RNA complex; complexed with anp, mg

Details for d2j0qd1

PDB Entry: 2j0q (more details), 3.2 Å

PDB Description: the crystal structure of the exon junction complex at 3.2 a resolution
PDB Compounds: (D:) RNA-binding protein 8A

SCOPe Domain Sequences for d2j0qd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0qd1 d.58.7.1 (D:66-154) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
eaqaameglngqdlmgqpisvdwcfvrgp

SCOPe Domain Coordinates for d2j0qd1:

Click to download the PDB-style file with coordinates for d2j0qd1.
(The format of our PDB-style files is described here.)

Timeline for d2j0qd1: