| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
| Protein RNA-binding protein 8 [89938] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102978] (4 PDB entries) RBM8A, Y14 |
| Domain d2j0qd1: 2j0q D:66-154 [137909] Other proteins in same PDB: d2j0qa1, d2j0qa2, d2j0qb1, d2j0qb2, d2j0qc1, d2j0qf1 automatically matched to d1p27b_ complexed with anp, mg |
PDB Entry: 2j0q (more details), 3.2 Å
SCOP Domain Sequences for d2j0qd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0qd1 d.58.7.1 (D:66-154) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
eaqaameglngqdlmgqpisvdwcfvrgp
Timeline for d2j0qd1: