| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species) Eukaryotic translation initiation factor 4A isoform 3 |
| Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries) Uniprot P38919 22-243! Uniprot P38919 244-411 |
| Domain d2j0qb2: 2j0q B:244-411 [137907] Other proteins in same PDB: d2j0qc1, d2j0qd1, d2j0qf1, d2j0qg1 automatically matched to 2HYI C:244-411 protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0q (more details), 3.2 Å
SCOPe Domain Sequences for d2j0qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0qb2 c.37.1.19 (B:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih
rigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
Timeline for d2j0qb2: