Lineage for d2j0ob_ (2j0o B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016066Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2016067Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2016068Family a.250.1.1: IpaD-like [140694] (3 protein domains)
    Pfam PF06511
  6. 2016085Protein automated matches [191266] (1 species)
    not a true protein
  7. 2016086Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries)
  8. 2016089Domain d2j0ob_: 2j0o B: [137902]
    Other proteins in same PDB: d2j0oa1
    automated match to d2j0oa1
    complexed with gol

Details for d2j0ob_

PDB Entry: 2j0o (more details), 3 Å

PDB Description: shigella flexneri ipad
PDB Compounds: (B:) invasin ipad

SCOPe Domain Sequences for d2j0ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ob_ a.250.1.1 (B:) automated matches {Shigella flexneri [TaxId: 623]}
hpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldi
lsrheypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavs
sytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntv
sqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqa
wnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstissc

SCOPe Domain Coordinates for d2j0ob_:

Click to download the PDB-style file with coordinates for d2j0ob_.
(The format of our PDB-style files is described here.)

Timeline for d2j0ob_: