SCOPe 2.07: Domain d2j0oa1: 2j0o A:39-322

Lineage for d2j0oa1 (2j0o A:39-322)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.250: IpaD-like [140692] (1 superfamily)
   6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest

4. Superfamily a.250.1: IpaD-like [140693] (2 families)

5. Family a.250.1.1: IpaD-like [140694] (3 proteins)
   Pfam PF06511

6. Protein Invasin IpaD [140695] (1 species)

7. Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)
   Uniprot P18013 128-320! Uniprot P18013 144-314! Uniprot P18013 39-322

8. Domain d2j0oa1: 2j0o A:39-322 [137901]
   Other proteins in same PDB: d2j0ob_
   complexed with gol

Details for d2j0oa1

PDB Entry: 2j0o, 3 Å

PDB Description: shigella flexneri ipad

PDB Compounds: (A:) invasin ipad

SCOPe Domain Sequences for d2j0oa1:

Sequence; same for both SEQRES and ATOM records:

>d2j0oa1 a.250.1.1 (A:39-322) Invasin IpaD {Shigella flexneri [TaxId: 623]}
hpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldi
lsrheypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavs
sytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntv
sqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqa
wnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstissc

Timeline for d2j0oa1:

• d2j0oa1 first appeared in SCOP 1.73
  
• d2j0oa1 appears in SCOPe 2.06
  
• d2j0oa1 appears in the current release, SCOPe 2.08