SCOP 1.73: Domain d2j0nb1: 2j0n B:144-314

Lineage for d2j0nb1 (2j0n B:144-314)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.250: IpaD-like [140692] (1 superfamily)
   6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest

4. Superfamily a.250.1: IpaD-like [140693] (1 family)

5. Family a.250.1.1: IpaD-like [140694] (2 proteins)
   Pfam PF06511

6. Protein Invasin IpaD [140695] (1 species)

7. Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)

8. Domain d2j0nb1: 2j0n B:144-314 [137900]
   automatically matched to 2J0N A:144-314

Details for d2j0nb1

PDB Entry: 2j0n, 2.1 Å

PDB Description: a proteolytically truncated form of shigella flexneri ipad

PDB Compounds: (B:) invasin ipad

SCOP Domain Sequences for d2j0nb1:

Sequence; same for both SEQRES and ATOM records:

>d2j0nb1 a.250.1.1 (B:144-314) Invasin IpaD {Shigella flexneri [TaxId: 623]}
dineqylkvyehavssytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelk
ekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnl
ggngevvldnakyqawnagfsaedetmknnlqtlvqkysnansifdnlvkv

Timeline for d2j0nb1:

• d2j0nb1 is new in SCOP 1.73
  
• d2j0nb1 appears in SCOP 1.75
  
• d2j0nb1 appears in the current release, SCOPe 2.08, called d2j0nb_