Lineage for d2j08a2 (2j08 A:2-171)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470051Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2470052Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2470053Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins)
  6. 2470065Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 2470080Species Thermus thermophilus [TaxId:274] [69460] (5 PDB entries)
  8. 2470085Domain d2j08a2: 2j08 A:2-171 [137894]
    Other proteins in same PDB: d2j08a1
    automated match to d1iqra2
    complexed with cl, fad, irf, po4

Details for d2j08a2

PDB Entry: 2j08 (more details), 2.61 Å

PDB Description: thermus dna photolyase with 8-iod-riboflavin antenna chromophore
PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOPe Domain Sequences for d2j08a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j08a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]}
gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg

SCOPe Domain Coordinates for d2j08a2:

Click to download the PDB-style file with coordinates for d2j08a2.
(The format of our PDB-style files is described here.)

Timeline for d2j08a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j08a1