SCOPe 2.06: Domain d2j07a2: 2j07 A:2-171

Lineage for d2j07a2 (2j07 A:2-171)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins)

6. Protein DNA photolyase [52427] (3 species)
   binds a light-harvesting cofactor

7. Species Thermus thermophilus [TaxId:274] [69460] (5 PDB entries)

8. Domain d2j07a2: 2j07 A:2-171 [137892]
   Other proteins in same PDB: d2j07a1
   automated match to d1iqra2
   complexed with cl, fad, hdf, po4

Details for d2j07a2

PDB Entry: 2j07, 1.95 Å

PDB Description: thermus dna photolyase with 8-hdf antenna chromophore

PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOPe Domain Sequences for d2j07a2:

Sequence; same for both SEQRES and ATOM records:

>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]}
gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg

Timeline for d2j07a2:

• d2j07a2 first appeared in SCOP 1.73
  
• d2j07a2 appears in SCOPe 2.05
  
• d2j07a2 appears in SCOPe 2.07
  
• d2j07a2 appears in the current release, SCOPe 2.08