Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) |
Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) |
Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
Species Thermus thermophilus [TaxId:274] [69460] (5 PDB entries) |
Domain d2j07a2: 2j07 A:2-171 [137892] Other proteins in same PDB: d2j07a1 automatically matched to d1iqra2 complexed with cl, fad, hdf, po4 |
PDB Entry: 2j07 (more details), 1.95 Å
SCOPe Domain Sequences for d2j07a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg
Timeline for d2j07a2: