Lineage for d2j07a1 (2j07 A:172-420)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276262Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 1276263Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 1276264Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. 1276265Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 1276280Species Thermus thermophilus [TaxId:274] [69083] (5 PDB entries)
  8. 1276281Domain d2j07a1: 2j07 A:172-420 [137891]
    Other proteins in same PDB: d2j07a2
    automated match to d1iqra1
    complexed with cl, fad, hdf, po4

Details for d2j07a1

PDB Entry: 2j07 (more details), 1.95 Å

PDB Description: thermus dna photolyase with 8-hdf antenna chromophore
PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOPe Domain Sequences for d2j07a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j07a1 a.99.1.1 (A:172-420) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrryl
rlardlarg

SCOPe Domain Coordinates for d2j07a1:

Click to download the PDB-style file with coordinates for d2j07a1.
(The format of our PDB-style files is described here.)

Timeline for d2j07a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j07a2