SCOP 1.75: Domain d2j03o1: 2j03 O:1-122

Lineage for d2j03o1 (2j03 O:1-122)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Thermus thermophilus [TaxId:274] [141308] (9 PDB entries)
   Uniprot Q5SHP8 1-122

8. Domain d2j03o1: 2j03 O:1-122 [137890]
   Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
   automatically matched to 2J01 O:1-122
   complexed with lys

Details for d2j03o1

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (O:) 50S ribosomal protein L14

SCOP Domain Sequences for d2j03o1:

Sequence; same for both SEQRES and ATOM records:

>d2j03o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

Timeline for d2j03o1:

• d2j03o1 first appeared in SCOP 1.73
  
• d2j03o1 appears in SCOPe 2.01
  
• d2j03o1 appears in the current release, SCOPe 2.08