Lineage for d2j03o1 (2j03 O:1-122)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667238Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 667239Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 667240Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 667241Protein Ribosomal protein L14 [50195] (3 species)
  7. 667289Species Thermus thermophilus [TaxId:274] [141308] (2 PDB entries)
  8. 667291Domain d2j03o1: 2j03 O:1-122 [137890]
    Other proteins in same PDB: d2j0321, d2j03c1, d2j03i1, d2j03i2
    automatically matched to 2J01 O:1-122
    complexed with lys

Details for d2j03o1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (O:) 50S ribosomal protein L14

SCOP Domain Sequences for d2j03o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

SCOP Domain Coordinates for d2j03o1:

Click to download the PDB-style file with coordinates for d2j03o1.
(The format of our PDB-style files is described here.)

Timeline for d2j03o1: