Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) |
Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
Protein Ribosomal protein L9 C-domain [55655] (3 species) |
Species Thermus thermophilus [TaxId:274] [143635] (5 PDB entries) Uniprot Q5SLQ1 55-146 |
Domain d2j03i1: 2j03 I:56-146 [137888] Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 automatically matched to 2J01 I:56-146 complexed with lys |
PDB Entry: 2j03 (more details), 2.8 Å
SCOP Domain Sequences for d2j03i1:
Sequence, based on SEQRES records: (download)
>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla lekpikelgeyvltykphpevpiqlkvsvva
>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla lekpikelgeyvltykphpevpiqlkvsvvv
Timeline for d2j03i1:
View in 3D Domains from other chains: (mouse over for more information) d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 |