Lineage for d2j03i1 (2j03 I:56-146)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869297Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 869298Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
  5. 869299Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 869300Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 869337Species Thermus thermophilus [TaxId:274] [143635] (5 PDB entries)
    Uniprot Q5SLQ1 55-146
  8. 869339Domain d2j03i1: 2j03 I:56-146 [137888]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    automatically matched to 2J01 I:56-146
    complexed with lys

Details for d2j03i1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2j03i1:

Sequence, based on SEQRES records: (download)

>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvva

Sequence, based on observed residues (ATOM records): (download)

>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvv

SCOP Domain Coordinates for d2j03i1:

Click to download the PDB-style file with coordinates for d2j03i1.
(The format of our PDB-style files is described here.)

Timeline for d2j03i1: