Lineage for d2j03c1 (2j03 C:18-224)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1235695Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 1235696Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
  5. 1235697Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 1235698Protein Ribosomal protein L1 [56810] (4 species)
  7. 1235709Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 1235716Domain d2j03c1: 2j03 C:18-224 [137887]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    automatically matched to 2J01 C:18-224
    protein/RNA complex

Details for d2j03c1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOPe Domain Sequences for d2j03c1:

Sequence, based on SEQRES records: (download)

>d2j03c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll
pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale
ahkpegakgtflrsvyvtttmgpsvri

Sequence, based on observed residues (ATOM records): (download)

>d2j03c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri

SCOPe Domain Coordinates for d2j03c1:

Click to download the PDB-style file with coordinates for d2j03c1.
(The format of our PDB-style files is described here.)

Timeline for d2j03c1: