SCOP 1.73: Domain d2j03c1: 2j03 C:18-224

Lineage for d2j03c1 (2j03 C:18-224)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56811] (3 PDB entries)

8. Domain d2j03c1: 2j03 C:18-224 [137887]
   Other proteins in same PDB: d2j0321, d2j03i1, d2j03i2, d2j03o1
   automatically matched to 2J01 C:18-224
   complexed with lys

Details for d2j03c1

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (C:) 50s ribosomal protein l1

SCOP Domain Sequences for d2j03c1:

Sequence, based on SEQRES records:

>d2j03c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll
pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale
ahkpegakgtflrsvyvtttmgpsvri

Sequence, based on observed residues (ATOM records):

>d2j03c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri

Timeline for d2j03c1:

• d2j03c1 is new in SCOP 1.73
  
• d2j03c1 appears in SCOP 1.75
  
• d2j03c1 appears in the current release, SCOPe 2.08