Lineage for d2j0321 (2j03 2:12-62)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979846Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1979847Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1979848Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1979932Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
    Uniprot Q5SHP6 12-62
  8. 1979933Domain d2j0321: 2j03 2:12-62 [137886]
    Other proteins in same PDB: d2j0311, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j0321

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (2:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2j0321:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0321 a.2.2.1 (2:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt

SCOPe Domain Coordinates for d2j0321:

Click to download the PDB-style file with coordinates for d2j0321.
(The format of our PDB-style files is described here.)

Timeline for d2j0321: