Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) automatically mapped to Pfam PF00831 |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries) Uniprot Q5SHP6 12-62 |
Domain d2j0321: 2j03 2:12-62 [137886] Other proteins in same PDB: d2j0311, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 protein/RNA complex protein/RNA complex |
PDB Entry: 2j03 (more details), 2.8 Å
SCOPe Domain Sequences for d2j0321:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0321 a.2.2.1 (2:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]} earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt
Timeline for d2j0321:
View in 3D Domains from other chains: (mouse over for more information) d2j0311, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1 |