SCOP 1.75: Domain d2j0321: 2j03 2:12-62

Lineage for d2j0321 (2j03 2:12-62)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Thermus thermophilus [TaxId:274] [140100] (6 PDB entries)
   Uniprot Q5SHP6 12-62

8. Domain d2j0321: 2j03 2:12-62 [137886]
   Other proteins in same PDB: d2j0311, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
   automatically matched to 2J01 2:12-62
   complexed with lys

Details for d2j0321

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (2:) 50S ribosomal protein L29

SCOP Domain Sequences for d2j0321:

Sequence; same for both SEQRES and ATOM records:

>d2j0321 a.2.2.1 (2:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt

Timeline for d2j0321:

• d2j0321 first appeared in SCOP 1.73
  
• d2j0321 appears in SCOPe 2.01
  
• d2j0321 appears in the current release, SCOPe 2.08