Class a: All alpha proteins [46456] (258 folds) |
Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (4 species) |
Species Thermus thermophilus [TaxId:274] [140100] (3 PDB entries) |
Domain d2j0321: 2j03 2:12-62 [137886] Other proteins in same PDB: d2j03c1, d2j03i1, d2j03i2, d2j03o1 automatically matched to 2J01 2:12-62 complexed with lys |
PDB Entry: 2j03 (more details), 2.8 Å
SCOP Domain Sequences for d2j0321:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0321 a.2.2.1 (2:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]} earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt
Timeline for d2j0321:
View in 3D Domains from other chains: (mouse over for more information) d2j03c1, d2j03i1, d2j03i2, d2j03o1 |