Lineage for d2j0321 (2j03 2:12-62)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633322Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 633323Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 633324Protein Ribosomal protein L29 (L29p) [46563] (4 species)
  7. 633382Species Thermus thermophilus [TaxId:274] [140100] (3 PDB entries)
  8. 633384Domain d2j0321: 2j03 2:12-62 [137886]
    Other proteins in same PDB: d2j03c1, d2j03i1, d2j03i2, d2j03o1
    automatically matched to 2J01 2:12-62
    complexed with lys

Details for d2j0321

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (2:) 50S ribosomal protein L29

SCOP Domain Sequences for d2j0321:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0321 a.2.2.1 (2:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt

SCOP Domain Coordinates for d2j0321:

Click to download the PDB-style file with coordinates for d2j0321.
(The format of our PDB-style files is described here.)

Timeline for d2j0321: