![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) |
![]() | Domain d2j02s1: 2j02 S:4-82 [137884] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02t1 automatically matched to d1fjgs_ complexed with 5mu, mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOP Domain Sequences for d2j02s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02s1 d.28.1.1 (S:4-82) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} slkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvyit enmvghklgefaptrtyrg
Timeline for d2j02s1: