Lineage for d2j02s1 (2j02 S:4-82)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720813Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 720814Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 720815Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 720816Protein Ribosomal protein S19 [54572] (1 species)
  7. 720817Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
  8. 720825Domain d2j02s1: 2j02 S:4-82 [137884]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02t1
    automatically matched to d1fjgs_
    complexed with 5mu, mg, par, zn

Details for d2j02s1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d2j02s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02s1 d.28.1.1 (S:4-82) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
slkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvyit
enmvghklgefaptrtyrg

SCOP Domain Coordinates for d2j02s1:

Click to download the PDB-style file with coordinates for d2j02s1.
(The format of our PDB-style files is described here.)

Timeline for d2j02s1: