| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
| Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
| Protein Ribosomal protein S18 [46913] (2 species) |
| Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
| Domain d2j02r1: 2j02 R:19-88 [137883] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02s1, d2j02t1, d2j02u1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOPe Domain Sequences for d2j02r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02r1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk
Timeline for d2j02r1: