Lineage for d2j02h1 (2j02 H:1-138)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734191Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 734192Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 734193Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 734194Protein Ribosomal protein S8 [56049] (4 species)
  7. 734212Species Thermus thermophilus [TaxId:274] [56051] (37 PDB entries)
  8. 734222Domain d2j02h1: 2j02 H:1-138 [137873]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1
    automatically matched to d1fjgh_
    complexed with 5mu, mg, par, zn

Details for d2j02h1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2j02h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02h1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d2j02h1:

Click to download the PDB-style file with coordinates for d2j02h1.
(The format of our PDB-style files is described here.)

Timeline for d2j02h1: