![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (42 PDB entries) |
![]() | Domain d2j02f1: 2j02 F:1-101 [137871] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1 automatically matched to d1fjgf_ complexed with 5mu, mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOP Domain Sequences for d2j02f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02f1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2j02f1: