![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
![]() | Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) lacks the N-terminal helix |
![]() | Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) |
![]() | Domain d2j02e2: 2j02 E:5-73 [137870] Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1 automatically matched to d1i94e2 complexed with 5mu, mg, par, zn |
PDB Entry: 2j02 (more details), 2.8 Å
SCOP Domain Sequences for d2j02e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j02e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d2j02e2: