Lineage for d2j02e1 (2j02 E:74-154)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1016993Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1017034Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1017062Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 1017076Domain d2j02e1: 2j02 E:74-154 [137869]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
    automatically matched to d1i94e1
    protein/RNA complex; complexed with mg, par, zn

Details for d2j02e1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2j02e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2j02e1:

Click to download the PDB-style file with coordinates for d2j02e1.
(The format of our PDB-style files is described here.)

Timeline for d2j02e1: