SCOPe 2.05: Domain d2j01o1: 2j01 O:1-122

Lineage for d2j01o1 (2j01 O:1-122)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries)
   Uniprot Q5SHP8 1-122

8. Domain d2j01o1: 2j01 O:1-122 [137864]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   protein/RNA complex
   protein/RNA complex

Details for d2j01o1

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (O:) 50S ribosomal protein L14

SCOPe Domain Sequences for d2j01o1:

Sequence; same for both SEQRES and ATOM records:

>d2j01o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

Timeline for d2j01o1:

• d2j01o1 first appeared in SCOP 1.73
  
• d2j01o1 appears in SCOPe 2.04
  
• d2j01o1 appears in SCOPe 2.06
  
• d2j01o1 appears in the current release, SCOPe 2.08