SCOPe 2.06: Domain d2j01i1: 2j01 I:56-146

Lineage for d2j01i1 (2j01 I:56-146)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)
   automatically mapped to Pfam PF03948

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (3 species)

7. Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
   Uniprot Q5SLQ1 55-146

8. Domain d2j01i1: 2j01 I:56-146 [137862]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   protein/RNA complex
   protein/RNA complex

Details for d2j01i1

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2j01i1:

Sequence; same for both SEQRES and ATOM records:

>d2j01i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvva

Timeline for d2j01i1:

• d2j01i1 first appeared in SCOP 1.73
  
• d2j01i1 appears in SCOPe 2.05
  
• d2j01i1 appears in SCOPe 2.07
  
• d2j01i1 appears in the current release, SCOPe 2.08