![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) ![]() automatically mapped to Pfam PF03948 |
![]() | Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
![]() | Protein Ribosomal protein L9 C-domain [55655] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries) Uniprot Q5SLQ1 55-146 |
![]() | Domain d2j01i1: 2j01 I:56-146 [137862] Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 protein/RNA complex |
PDB Entry: 2j01 (more details), 2.8 Å
SCOPe Domain Sequences for d2j01i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j01i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla lekpikelgeyvltykphpevpiqlkvsvva
Timeline for d2j01i1:
![]() Domains from other chains: (mouse over for more information) d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 |