Lineage for d2j0121 (2j01 2:12-62)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633322Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 633323Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 633324Protein Ribosomal protein L29 (L29p) [46563] (4 species)
  7. 633382Species Thermus thermophilus [TaxId:274] [140100] (3 PDB entries)
  8. 633383Domain d2j0121: 2j01 2:12-62 [137860]
    Other proteins in same PDB: d2j0111, d2j01c1, d2j01i1, d2j01i2, d2j01o1

Details for d2j0121

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (2:) 50S ribosomal protein L29

SCOP Domain Sequences for d2j0121:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0121 a.2.2.1 (2:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt

SCOP Domain Coordinates for d2j0121:

Click to download the PDB-style file with coordinates for d2j0121.
(The format of our PDB-style files is described here.)

Timeline for d2j0121: