Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (3 species) |
Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
Domain d2j00p1: 2j00 P:1-83 [137854] Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j00 (more details), 2.8 Å
SCOPe Domain Sequences for d2j00p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j00p1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2j00p1: