| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
| Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
| Protein Ribosomal protein S13 [46948] (1 species) |
| Species Thermus thermophilus [TaxId:274] [46949] (36 PDB entries) |
| Domain d2j00m1: 2j00 M:2-126 [137851] Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1 automatically matched to d1fjgm_ complexed with 5mu, mg, par, zn |
PDB Entry: 2j00 (more details), 2.8 Å
SCOP Domain Sequences for d2j00m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j00m1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk
Timeline for d2j00m1: