Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
Domain d2j00h1: 2j00 H:1-138 [137846] Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1 automatically matched to d1fjgh_ protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j00 (more details), 2.8 Å
SCOPe Domain Sequences for d2j00h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j00h1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2j00h1: