Lineage for d2j00h1 (2j00 H:1-138)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219328Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1219329Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 1219330Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1219331Protein Ribosomal protein S8 [56049] (4 species)
  7. 1219349Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1219368Domain d2j00h1: 2j00 H:1-138 [137846]
    Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1
    automatically matched to d1fjgh_
    protein/RNA complex; complexed with mg, par, zn

Details for d2j00h1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2j00h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00h1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2j00h1:

Click to download the PDB-style file with coordinates for d2j00h1.
(The format of our PDB-style files is described here.)

Timeline for d2j00h1: