![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) Uniprot P27152 Uniprot P80373 Uniprot P27152 ! Uniprot P80373 |
![]() | Domain d2j00e1: 2j00 E:74-154 [137842] Other proteins in same PDB: d2j00b1, d2j00c1, d2j00c2, d2j00d1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1 automatically matched to d1i94e1 complexed with 5mu, mg, par, zn |
PDB Entry: 2j00 (more details), 2.8 Å
SCOP Domain Sequences for d2j00e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j00e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d2j00e1: