Lineage for d2j00c1 (2j00 C:2-106)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860215Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860216Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 860229Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 860259Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
    Uniprot P80372
  8. 860273Domain d2j00c1: 2j00 C:2-106 [137839]
    Other proteins in same PDB: d2j00b1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1
    automatically matched to d1fjgc1
    complexed with 5mu, mg, par, zn

Details for d2j00c1

PDB Entry: 2j00 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule I.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2j00c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j00c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d2j00c1:

Click to download the PDB-style file with coordinates for d2j00c1.
(The format of our PDB-style files is described here.)

Timeline for d2j00c1: