Lineage for d2izyh2 (2izy H:5-47)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322371Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2322372Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2322373Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2322391Protein automated matches [190321] (3 species)
    not a true protein
  7. 2322409Species Mouse (Mus musculus) [TaxId:10090] [187154] (1 PDB entry)
  8. 2322417Domain d2izyh2: 2izy H:5-47 [137837]
    Other proteins in same PDB: d2izya3, d2izyb3, d2izyc3, d2izyd3, d2izye3, d2izyf3, d2izyg3, d2izyh3
    automated match to d1l6ea_

Details for d2izyh2

PDB Entry: 2izy (more details), 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits
PDB Compounds: (H:) camp-dependent protein kinase regulatory subunit II

SCOPe Domain Sequences for d2izyh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izyh2 a.31.1.1 (H:5-47) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrg

SCOPe Domain Coordinates for d2izyh2:

Click to download the PDB-style file with coordinates for d2izyh2.
(The format of our PDB-style files is described here.)

Timeline for d2izyh2: