Lineage for d2izyd1 (2izy D:6-46)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640145Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 640146Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) (S)
    dimer of identical alpha-hairpin motifs
  5. 640147Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)
  6. 640152Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 640153Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)
  8. 640161Domain d2izyd1: 2izy D:6-46 [137833]
    automatically matched to d1l6ea_

Details for d2izyd1

PDB Entry: 2izy (more details), 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits
PDB Compounds: (D:) camp-dependent protein kinase regulatory subunit II

SCOP Domain Sequences for d2izyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izyd1 a.31.1.1 (D:6-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
qippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOP Domain Coordinates for d2izyd1:

Click to download the PDB-style file with coordinates for d2izyd1.
(The format of our PDB-style files is described here.)

Timeline for d2izyd1: