SCOP 1.73: Domain d2izya1: 2izy A:6-46

Lineage for d2izya1 (2izy A:6-46)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)

6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)

8. Domain d2izya1: 2izy A:6-46 [137830]
   automatically matched to d1l6ea_

Details for d2izya1

PDB Entry: 2izy, 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits

PDB Compounds: (A:) camp-dependent protein kinase regulatory subunit II

SCOP Domain Sequences for d2izya1:

Sequence; same for both SEQRES and ATOM records:

>d2izya1 a.31.1.1 (A:6-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
qippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d2izya1:

• d2izya1 is new in SCOP 1.73
  
• d2izya1 appears in SCOP 1.75
  
• d2izya1 appears in the current release, SCOPe 2.08, called d2izya2