![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Elongin C [54699] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54700] (19 PDB entries) |
![]() | Domain d2izvc_: 2izv C: [137829] Other proteins in same PDB: d2izva1, d2izva2, d2izvb_ automated match to d1lm8c_ complexed with cl, edo, na |
PDB Entry: 2izv (more details), 2.55 Å
SCOPe Domain Sequences for d2izvc_:
Sequence, based on SEQRES records: (download)
>d2izvc_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d2izvc_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnss teipefpiapeialellmaanfldc
Timeline for d2izvc_: