SCOPe 2.06: Domain d2iznc_: 2izn C:

Lineage for d2iznc_ (2izn C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
   Uniprot P03612

8. Domain d2iznc_: 2izn C: [137825]
   automated match to d1dzsa_
   protein/RNA complex

Details for d2iznc_

PDB Entry: 2izn, 2.56 Å

PDB Description: ms2-rna hairpin (g-10) complex

PDB Compounds: (C:) ms2 coat protein

SCOPe Domain Sequences for d2iznc_:

Sequence; same for both SEQRES and ATOM records:

>d2iznc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d2iznc_:

• d2iznc_ first appeared in SCOP 1.73, called d2iznc1
  
• d2iznc_ appears in SCOPe 2.05
  
• d2iznc_ appears in SCOPe 2.07
  
• d2iznc_ appears in the current release, SCOPe 2.08