Lineage for d2iznc1 (2izn C:1-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728525Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 728526Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 728527Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 728576Protein MS2 virus coat protein [55407] (1 species)
  7. 728577Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries)
  8. 728587Domain d2iznc1: 2izn C:1-129 [137825]
    automatically matched to d1dzsa_

Details for d2iznc1

PDB Entry: 2izn (more details), 2.56 Å

PDB Description: ms2-rna hairpin (g-10) complex
PDB Compounds: (C:) ms2 coat protein

SCOP Domain Sequences for d2iznc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iznc1 d.85.1.1 (C:1-129) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d2iznc1:

Click to download the PDB-style file with coordinates for d2iznc1.
(The format of our PDB-style files is described here.)

Timeline for d2iznc1: