Lineage for d2izna_ (2izn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962492Protein MS2 virus coat protein [55407] (1 species)
  7. 2962493Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2962501Domain d2izna_: 2izn A: [137823]
    automated match to d1dzsa_
    protein/RNA complex

Details for d2izna_

PDB Entry: 2izn (more details), 2.56 Å

PDB Description: ms2-rna hairpin (g-10) complex
PDB Compounds: (A:) ms2 coat protein

SCOPe Domain Sequences for d2izna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izna_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2izna_:

Click to download the PDB-style file with coordinates for d2izna_.
(The format of our PDB-style files is described here.)

Timeline for d2izna_: