Lineage for d2iz9a1 (2iz9 A:1-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867038Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 867039Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 867040Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 867089Protein MS2 virus coat protein [55407] (1 species)
  7. 867090Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries)
    Uniprot P03612
  8. 867131Domain d2iz9a1: 2iz9 A:1-129 [137820]
    automatically matched to d1dzsa_
    complexed with one

Details for d2iz9a1

PDB Entry: 2iz9 (more details), 2.85 Å

PDB Description: ms2-rna hairpin (4one -5) complex
PDB Compounds: (A:) ms2 coat protein

SCOP Domain Sequences for d2iz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iz9a1 d.85.1.1 (A:1-129) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d2iz9a1:

Click to download the PDB-style file with coordinates for d2iz9a1.
(The format of our PDB-style files is described here.)

Timeline for d2iz9a1: