Lineage for d2iyya_ (2iyy A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. Protein automated matches [190331] (1 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries)
  8. Domain d2iyya_: 2iyy A: [137815]
    automated match to d1l4ua_
    complexed with cl, mg, po4, s3p, so4

Details for d2iyya_

PDB Entry: 2iyy (more details), 1.62 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and so4
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d2iyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyya_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps

SCOPe Domain Coordinates for d2iyya_ are not available.

Timeline for d2iyya_: