SCOP 1.73: Domain d2iyxa1: 2iyx A:2-166

Lineage for d2iyxa1 (2iyx A:2-166)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.2: Shikimate kinase (AroK) [52566] (1 protein)
   similar to the nucleotide/nucleoside kinases but acts on different substrate

6. Protein Shikimate kinase (AroK) [52567] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75194] (19 PDB entries)

8. Domain d2iyxa1: 2iyx A:2-166 [137814]
   automatically matched to d1l4ua_
   complexed with cl, mg, skm, so4

Details for d2iyxa1

PDB Entry: 2iyx, 1.49 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate and so4

PDB Compounds: (A:) Shikimate kinase

SCOP Domain Sequences for d2iyxa1:

Sequence; same for both SEQRES and ATOM records:

>d2iyxa1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

Timeline for d2iyxa1:

• d2iyxa1 is new in SCOP 1.73
  
• d2iyxa1 appears in SCOP 1.75
  
• d2iyxa1 appears in the current release, SCOPe 2.08, called d2iyxa_