| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins) similar to the nucleotide/nucleoside kinases but acts on different substrate automatically mapped to Pfam PF01202 |
| Protein automated matches [190331] (1 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries) |
| Domain d2iyva2: 2iyv A:2-176 [137812] Other proteins in same PDB: d2iyva3 automated match to d1l4ua_ complexed with adp, cl |
PDB Entry: 2iyv (more details), 1.35 Å
SCOPe Domain Sequences for d2iyva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iyva2 c.37.1.2 (A:2-176) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaat
Timeline for d2iyva2: