SCOPe 2.07: Domain d2iyva2: 2iyv A:2-176

Lineage for d2iyva2 (2iyv A:2-176)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
   similar to the nucleotide/nucleoside kinases but acts on different substrate
   automatically mapped to Pfam PF01202

6. Protein automated matches [190331] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries)

8. Domain d2iyva2: 2iyv A:2-176 [137812]
   Other proteins in same PDB: d2iyva3
   automated match to d1l4ua_
   complexed with adp, cl

Details for d2iyva2

PDB Entry: 2iyv, 1.35 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. b)

PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d2iyva2:

Sequence; same for both SEQRES and ATOM records:

>d2iyva2 c.37.1.2 (A:2-176) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaat

Timeline for d2iyva2:

• d2iyva2 first appeared in SCOP 1.73, called d2iyva1
  
• d2iyva2 appears in SCOPe 2.06
  
• d2iyva2 appears in the current release, SCOPe 2.08