![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins) similar to the nucleotide/nucleoside kinases but acts on different substrate automatically mapped to Pfam PF01202 |
![]() | Protein automated matches [190331] (1 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries) |
![]() | Domain d2iyua_: 2iyu A: [137811] automated match to d1l4ua_ complexed with adp, cl |
PDB Entry: 2iyu (more details), 1.85 Å
SCOPe Domain Sequences for d2iyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iyua_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqv
Timeline for d2iyua_: