| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins) similar to the nucleotide/nucleoside kinases but acts on different substrate automatically mapped to Pfam PF01202 |
| Protein automated matches [190331] (1 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries) |
| Domain d2iyqa_: 2iyq A: [137806] automated match to d1l4ua_ complexed with adp, cl, skm, trs |
PDB Entry: 2iyq (more details), 1.8 Å
SCOPe Domain Sequences for d2iyqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iyqa_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlq
Timeline for d2iyqa_: