Lineage for d2iync_ (2iyn C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855749Species Escherichia coli [TaxId:562] [186909] (5 PDB entries)
  8. 2855761Domain d2iync_: 2iyn C: [137805]
    automated match to d1b00a_
    complexed with mg

Details for d2iync_

PDB Entry: 2iyn (more details), 2.08 Å

PDB Description: the co-factor-induced pre-active conformation in phob
PDB Compounds: (C:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2iync_:

Sequence, based on SEQRES records: (download)

>d2iync_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr

Sequence, based on observed residues (ATOM records): (download)

>d2iync_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltatgaddyitkpfspkelvarikavmrr

SCOPe Domain Coordinates for d2iync_:

Click to download the PDB-style file with coordinates for d2iync_.
(The format of our PDB-style files is described here.)

Timeline for d2iync_: