Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein automated matches [190177] (9 species) not a true protein |
Species Escherichia coli [TaxId:562] [186909] (5 PDB entries) |
Domain d2iync_: 2iyn C: [137805] automated match to d1b00a_ complexed with mg |
PDB Entry: 2iyn (more details), 2.08 Å
SCOPe Domain Sequences for d2iync_:
Sequence, based on SEQRES records: (download)
>d2iync_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]} rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr
>d2iync_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]} rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi qfikhlkresmtrdipvvmltatgaddyitkpfspkelvarikavmrr
Timeline for d2iync_: