Lineage for d2iyna1 (2iyn A:3-121)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825643Protein PhoB receiver domain [52192] (2 species)
  7. 825644Species Escherichia coli [TaxId:562] [52193] (3 PDB entries)
  8. 825650Domain d2iyna1: 2iyn A:3-121 [137803]
    automatically matched to d1b00a_
    complexed with mg

Details for d2iyna1

PDB Entry: 2iyn (more details), 2.08 Å

PDB Description: the co-factor-induced pre-active conformation in phob
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOP Domain Sequences for d2iyna1:

Sequence, based on SEQRES records: (download)

>d2iyna1 c.23.1.1 (A:3-121) PhoB receiver domain {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr

Sequence, based on observed residues (ATOM records): (download)

>d2iyna1 c.23.1.1 (A:3-121) PhoB receiver domain {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargetgaddyitkpfspkelvarikavmr

SCOP Domain Coordinates for d2iyna1:

Click to download the PDB-style file with coordinates for d2iyna1.
(The format of our PDB-style files is described here.)

Timeline for d2iyna1: