![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein SUMO-2 [117816] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117817] (10 PDB entries) |
![]() | Domain d2iydb1: 2iyd B:14-92 [137800] automatically matched to 2CKH B:14-92 |
PDB Entry: 2iyd (more details), 3.2 Å
SCOP Domain Sequences for d2iydb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iydb1 d.15.1.1 (B:14-92) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa qlemededtidvfqqqtgg
Timeline for d2iydb1: